Recombinant Full Length Human NAA50 Protein, C-Flag-tagged
Cat.No. : | NAA50-1208HFL |
Product Overview : | Recombinant Full Length Human NAA50 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables H4 histone acetyltransferase activity; peptide alpha-N-acetyltransferase activity; and peptidyl-lysine acetyltransferase activity. Involved in N-terminal protein amino acid acetylation; establishment of mitotic sister chromatid cohesion; and mitotic sister chromatid cohesion, centromeric. Located in cytosol and nucleus. Part of NatA complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK RIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | NAA50 |
Synonyms | SAN; MAK3; NAT5; NAT13; NAT5P; NAT13P; hNaa50p |
Gene ID | 80218 |
mRNA Refseq | NM_025146.4 |
Protein Refseq | NP_079422.1 |
MIM | 610834 |
UniProt ID | Q9GZZ1 |
◆ Recombinant Proteins | ||
NAA50-467C | Recombinant Cynomolgus Monkey NAA50 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA50-2937R | Recombinant Rhesus monkey NAA50 Protein, His-tagged | +Inquiry |
NAA50-1208HFL | Recombinant Full Length Human NAA50 Protein, C-Flag-tagged | +Inquiry |
NAA50-1471H | Recombinant Human NAA50 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA50-722C | Recombinant Cynomolgus NAA50 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA50-3991HCL | Recombinant Human NAA50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAA50 Products
Required fields are marked with *
My Review for All NAA50 Products
Required fields are marked with *