Recombinant Full Length Human NAA50 Protein, C-Flag-tagged

Cat.No. : NAA50-1208HFL
Product Overview : Recombinant Full Length Human NAA50 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables H4 histone acetyltransferase activity; peptide alpha-N-acetyltransferase activity; and peptidyl-lysine acetyltransferase activity. Involved in N-terminal protein amino acid acetylation; establishment of mitotic sister chromatid cohesion; and mitotic sister chromatid cohesion, centromeric. Located in cytosol and nucleus. Part of NatA complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19.2 kDa
AA Sequence : MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK
RIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ]
Official Symbol NAA50
Synonyms SAN; MAK3; NAT5; NAT13; NAT5P; NAT13P; hNaa50p
Gene ID 80218
mRNA Refseq NM_025146.4
Protein Refseq NP_079422.1
MIM 610834
UniProt ID Q9GZZ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAA50 Products

Required fields are marked with *

My Review for All NAA50 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon