Recombinant Full Length Human NAA50 Protein, C-Flag-tagged

• Cat.No.: NAA50-1208HFL
• Product Overview: Recombinant Full Length Human NAA50 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables H4 histone acetyltransferase activity; peptide alpha-N-acetyltransferase activity; and peptidyl-lysine acetyltransferase activity. Involved in N-terminal protein amino acid acetylation; establishment of mitotic sister chromatid cohesion; and mitotic sister chromatid cohesion, centromeric. Located in cytosol and nucleus. Part of NatA complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 19.2 kDa
• AA Sequence: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK
  RIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ]
• Official Symbol: NAA50
• Synonyms: SAN; MAK3; NAT5; NAT13; NAT5P; NAT13P; hNaa50p
• Gene ID: 80218
• mRNA Refseq: NM_025146.4
• Protein Refseq: NP_079422.1
• MIM: 610834
• UniProt ID: Q9GZZ1