Recombinant Full Length Human NADK Protein, C-Flag-tagged
Cat.No. : | NADK-1354HFL |
Product Overview : | Recombinant Full Length Human NADK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | NADK catalyzes the transfer of a phosphate group from ATP to NAD to generate NADP, which in its reduced form acts as an electron donor for biosynthetic reactions. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49 kDa |
AA Sequence : | MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCP VTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK KVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLG FLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQY QVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICP HSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES LAQCLHWNVRKKQAHFEEEEEEEEEGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Full Length : | Full L. |
Gene Name | NADK NAD kinase [ Homo sapiens (human) ] |
Official Symbol | NADK |
Synonyms | dJ283E3.1 |
Gene ID | 65220 |
mRNA Refseq | NM_023018.5 |
Protein Refseq | NP_075394.3 |
MIM | 611616 |
UniProt ID | O95544 |
◆ Recombinant Proteins | ||
NADK-421H | Recombinant Human NADK Protein, His-tagged | +Inquiry |
NADK-1354HFL | Recombinant Full Length Human NADK Protein, C-Flag-tagged | +Inquiry |
NADK-1472H | Recombinant Human NADK Protein, His (Fc)-Avi-tagged | +Inquiry |
NADK-5893M | Recombinant Mouse NADK Protein, His (Fc)-Avi-tagged | +Inquiry |
NADK-278H | Recombinant Human NADK Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NADK-3986HCL | Recombinant Human NADK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NADK Products
Required fields are marked with *
My Review for All NADK Products
Required fields are marked with *
0
Inquiry Basket