Recombinant Full Length Human NAGS Protein, C-Flag-tagged
Cat.No. : | NAGS-1012HFL |
Product Overview : | Recombinant Full Length Human NAGS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58 kDa |
AA Sequence : | MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPPEEYAGADDVS QSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEARHWLTQFQTCHHSADKPFAV IEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHN AAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTAS LAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAV ITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD GSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | NAGS N-acetylglutamate synthase [ Homo sapiens (human) ] |
Official Symbol | NAGS |
Synonyms | AGAS; ARGA |
Gene ID | 162417 |
mRNA Refseq | NM_153006.3 |
Protein Refseq | NP_694551.1 |
MIM | 608300 |
UniProt ID | Q8N159 |
◆ Recombinant Proteins | ||
NAGS-5896M | Recombinant Mouse NAGS Protein, His (Fc)-Avi-tagged | +Inquiry |
NAGS-1012HFL | Recombinant Full Length Human NAGS Protein, C-Flag-tagged | +Inquiry |
NAGS-182H | Recombinant Human NAGS Protein, MYC/DDK-tagged | +Inquiry |
NAGS-1171H | Recombinant Human NAGS, His-tagged | +Inquiry |
Nags-1812M | Recombinant Mouse Nags Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAGS-429HCL | Recombinant Human NAGS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAGS Products
Required fields are marked with *
My Review for All NAGS Products
Required fields are marked with *
0
Inquiry Basket