Recombinant Full Length Human NDUFA7 Protein, C-Flag-tagged

• Cat.No.: NDUFA7-1989HFL
• Product Overview: Recombinant Full Length Human NDUFA7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12.4 kDa
• AA Sequence: MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
• Full Length: Full L.

Gene Information

• Gene Name: NDUFA7 NADH:ubiquinone oxidoreductase subunit A7 [ Homo sapiens (human) ]
• Official Symbol: NDUFA7
• Synonyms: B14.5a; CI-B14.5a
• Gene ID: 4701
• mRNA Refseq: NM_005001.5
• Protein Refseq: NP_004992.2
• MIM: 602139
• UniProt ID: O95182