Recombinant Full Length Human NDUFA7 Protein, C-Flag-tagged

Cat.No. : NDUFA7-1989HFL
Product Overview : Recombinant Full Length Human NDUFA7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 12.4 kDa
AA Sequence : MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Full Length : Full L.
Gene Name NDUFA7 NADH:ubiquinone oxidoreductase subunit A7 [ Homo sapiens (human) ]
Official Symbol NDUFA7
Synonyms B14.5a; CI-B14.5a
Gene ID 4701
mRNA Refseq NM_005001.5
Protein Refseq NP_004992.2
MIM 602139
UniProt ID O95182

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA7 Products

Required fields are marked with *

My Review for All NDUFA7 Products

Required fields are marked with *

0
cart-icon
0
compare icon