Recombinant Full Length Human NDUFA7 Protein, C-Flag-tagged
Cat.No. : | NDUFA7-1989HFL |
Product Overview : | Recombinant Full Length Human NDUFA7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Full Length : | Full L. |
Gene Name | NDUFA7 NADH:ubiquinone oxidoreductase subunit A7 [ Homo sapiens (human) ] |
Official Symbol | NDUFA7 |
Synonyms | B14.5a; CI-B14.5a |
Gene ID | 4701 |
mRNA Refseq | NM_005001.5 |
Protein Refseq | NP_004992.2 |
MIM | 602139 |
UniProt ID | O95182 |
◆ Recombinant Proteins | ||
NDUFA7-6419H | Recombinant Human NDUFA7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDUFA7-5972M | Recombinant Mouse NDUFA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFA7-10521M | Recombinant Mouse NDUFA7 Protein | +Inquiry |
NDUFA7-886Z | Recombinant Zebrafish NDUFA7 | +Inquiry |
NDUFA7-578H | Recombinant Human NDUFA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA7-3916HCL | Recombinant Human NDUFA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA7 Products
Required fields are marked with *
My Review for All NDUFA7 Products
Required fields are marked with *