Recombinant Full Length Human NECTIN4 Protein, C-Flag-tagged
Cat.No. : | NECTIN4-1064HFL |
Product Overview : | Recombinant Full Length Human NECTIN4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARV DAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQAR LRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHL VPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSY NWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENG TLRAKPTGNGIYINGRGHLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Adherens junction |
Full Length : | Full L. |
Gene Name | NECTIN4 nectin cell adhesion molecule 4 [ Homo sapiens (human) ] |
Official Symbol | NECTIN4 |
Synonyms | LNIR; PRR4; EDSS1; PVRL4; nectin-4 |
Gene ID | 81607 |
mRNA Refseq | NM_030916.3 |
Protein Refseq | NP_112178.2 |
MIM | 609607 |
UniProt ID | Q96NY8 |
◆ Recombinant Proteins | ||
NECTIN4-327H | Active Recombinant Human NECTIN4 protein, His-tagged | +Inquiry |
NECTIN4-1256M | Recombinant Mouse NECTIN4 protein(Met1-Ser347), His-tagged | +Inquiry |
NECTIN4-968HB | Recombinant Human NECTIN4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
NECTIN4-1694H | Recombinant Human NECTIN4 Protein (32-349 aa), His-tagged | +Inquiry |
NECTIN4-3793H | Recombinant Human NECTIN4 Protein (Ala31-Val351), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NECTIN4 Products
Required fields are marked with *
My Review for All NECTIN4 Products
Required fields are marked with *
0
Inquiry Basket