Recombinant Full Length Human Nedd4 Family-Interacting Protein 2(Ndfip2) Protein, His-Tagged
| Cat.No. : | RFL22741HF |
| Product Overview : | Recombinant Full Length Human NEDD4 family-interacting protein 2(NDFIP2) Protein (Q9NV92) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-336) |
| Form : | Lyophilized powder |
| AA Sequence : | MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | NDFIP2 |
| Synonyms | NDFIP2; KIAA1165; N4WBP5A; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413 |
| UniProt ID | Q9NV92 |
| ◆ Recombinant Proteins | ||
| NDFIP2-12527Z | Recombinant Zebrafish NDFIP2 | +Inquiry |
| RFL22741HF | Recombinant Full Length Human Nedd4 Family-Interacting Protein 2(Ndfip2) Protein, His-Tagged | +Inquiry |
| NDFIP2-2516C | Recombinant Chicken NDFIP2 | +Inquiry |
| RFL2692MF | Recombinant Full Length Mouse Nedd4 Family-Interacting Protein 2(Ndfip2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDFIP2-1175HCL | Recombinant Human NDFIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDFIP2 Products
Required fields are marked with *
My Review for All NDFIP2 Products
Required fields are marked with *
