Recombinant Full Length Human NEFL Protein, GST-tagged
Cat.No. : | NEFL-7008HF |
Product Overview : | Recombinant Human full-length NEFL(1 a.a. - 543 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 543 amino acids |
Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. |
Molecular Mass : | 87.9 kDa |
AA Sequence : | MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQ VAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAA EDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKK VHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKEYQDL LNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEE QIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEE EEKKVEGAGEEQAAKKKD |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NEFL neurofilament, light polypeptide [ Homo sapiens ] |
Official Symbol | NEFL |
Synonyms | NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL; neurofilament subunit NF-L; neurofilament triplet L protein; neurofilament protein, light chain; light molecular weig |
Gene ID | 4747 |
mRNA Refseq | NM_006158 |
Protein Refseq | NP_006149 |
MIM | 162280 |
UniProt ID | P07196 |
◆ Recombinant Proteins | ||
NEFL-233H | Recombinant Human NEFL Protein (Ser2-Asp543), N-His-SUMO tagged, Animal-free, Carrier-free | +Inquiry |
NEFL-2483H | Recombinant Human NEFL Protein, His-tagged | +Inquiry |
NEFL-4679H | Recombinant Human NEFL Protein (Met1-Asn352), N-His tagged | +Inquiry |
NEFL-1255H | Recombinant Human NEFL, His-tagged | +Inquiry |
NEFL-13H | Recombinant Human NEFL protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
NEFL-181B | Native bovine NEFL | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEFL Products
Required fields are marked with *
My Review for All NEFL Products
Required fields are marked with *
0
Inquiry Basket