Recombinant Full Length Human NEIL1 Protein, C-Flag-tagged
Cat.No. : | NEIL1-1659HFL |
Product Overview : | Recombinant Full Length Human NEIL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Base excision repair |
Full Length : | Full L. |
Gene Name | NEIL1 nei like DNA glycosylase 1 [ Homo sapiens (human) ] |
Official Symbol | NEIL1 |
Synonyms | FPG1; NEI1; hFPG1 |
Gene ID | 79661 |
mRNA Refseq | NM_024608.4 |
Protein Refseq | NP_078884.2 |
MIM | 608844 |
UniProt ID | Q96FI4 |
◆ Recombinant Proteins | ||
NEIL1-1659HFL | Recombinant Full Length Human NEIL1 Protein, C-Flag-tagged | +Inquiry |
NEIL1-2958H | Recombinant Human NEIL1 Protein (Met1-Lys269) | +Inquiry |
NEIL1-2291H | Recombinant Human NEIL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NEIL1-301252H | Recombinant Human NEIL1 protein, GST-tagged | +Inquiry |
Neil1-4365M | Recombinant Mouse Neil1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEIL1-3882HCL | Recombinant Human NEIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEIL1 Products
Required fields are marked with *
My Review for All NEIL1 Products
Required fields are marked with *
0
Inquiry Basket