Recombinant Full Length Human NFKB2 Protein, C-Flag-tagged
| Cat.No. : | NFKB2-559HFL | 
| Product Overview : | Recombinant Full Length Human NFKB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 96.5 kDa | 
| AA Sequence : | MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGAS SEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGV LHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSL PLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDF SPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPT FSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSR DSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTA QDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGAD PALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVD SGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKA GADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLT PPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDL AGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQ VHTRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
                                
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Transcription Factors | 
| Protein Pathways : | MAPK signaling pathway, Pathways in cancer | 
| Full Length : | Full L. | 
| Gene Name | NFKB2 nuclear factor kappa B subunit 2 [ Homo sapiens (human) ] | 
| Official Symbol | NFKB2 | 
| Synonyms | p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100 | 
| Gene ID | 4791 | 
| mRNA Refseq | NM_002502.6 | 
| Protein Refseq | NP_002493.3 | 
| MIM | 164012 | 
| UniProt ID | Q00653 | 
| ◆ Recombinant Proteins | ||
| NFKB2-815H | Recombinant Human NFKB2 Protein, MYC/DDK-tagged | +Inquiry | 
| NFKB2-1149C | Recombinant Chicken NFKB2 Protein, His-tagged | +Inquiry | 
| NFKB2-12HFL | Recombinant Human NFKB2 Protein, His tagged | +Inquiry | 
| NFKB2-4888H | Recombinant Human NFKB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Nfkb2-4397M | Recombinant Mouse Nfkb2 Protein, Myc/DDK-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NFKB2 Products
Required fields are marked with *
My Review for All NFKB2 Products
Required fields are marked with *
  
        
    
      
            