Recombinant Full Length Human NFYB Protein

• Cat.No.: NFYB-338HF
• Product Overview: Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 207 amino acids
• Description: The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants.
• Form: Liquid
• Molecular Mass: 48.510kDa inclusive of tags
• AA Sequence: MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: NFYB nuclear transcription factor Y, beta [ Homo sapiens ]
• Official Symbol: NFYB
• Synonyms: NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NFYB
• Gene ID: 4801
• mRNA Refseq: NM_006166
• Protein Refseq: NP_006157
• MIM: 189904
• UniProt ID: P25208