Recombinant Full Length Human NIT1 Protein, C-Flag-tagged
Cat.No. : | NIT1-1496HFL |
Product Overview : | Recombinant Full Length Human NIT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAEL VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQ KIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPE LSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGT VVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NIT1 nitrilase 1 [ Homo sapiens (human) ] |
Official Symbol | NIT1 |
Synonyms | MGC57670 |
Gene ID | 4817 |
mRNA Refseq | NM_005600.3 |
Protein Refseq | NP_005591.1 |
MIM | 604618 |
UniProt ID | Q86X76 |
◆ Recombinant Proteins | ||
NIT1-1513H | Recombinant Human NIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIT1-10681M | Recombinant Mouse NIT1 Protein | +Inquiry |
NIT1-6077M | Recombinant Mouse NIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIT1-01H | Recombinant Human NIT1 Protein, C-His tagged | +Inquiry |
NIT1-5879H | Recombinant Human NIT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIT1-3824HCL | Recombinant Human NIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIT1 Products
Required fields are marked with *
My Review for All NIT1 Products
Required fields are marked with *
0
Inquiry Basket