Recombinant Full Length Human NKIRAS2 Protein, GST-tagged
Cat.No. : | NKIRAS2-6666HF |
Product Overview : | Human NKIRAS2 full-length ORF ( AAH07450, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 191 amino acids |
Description : | NKIRAS2 (NFKB Inhibitor Interacting Ras Like 2) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS1. |
Molecular Mass : | 46.75 kDa |
AA Sequence : | MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ] |
Official Symbol | NKIRAS2 |
Synonyms | NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; kappa B-Ras protein 2; I-kappa-B-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like protein 2; kappaB-Ras2; MGC74742; DKFZp434N1526; |
Gene ID | 28511 |
mRNA Refseq | NM_001001349 |
Protein Refseq | NP_001001349 |
MIM | 604497 |
UniProt ID | Q9NYR9 |
◆ Recombinant Proteins | ||
NKIRAS2-2854R | Recombinant Rhesus Macaque NKIRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nkiras2-4422M | Recombinant Mouse Nkiras2 Protein, Myc/DDK-tagged | +Inquiry |
NKIRAS2-27758TH | Recombinant Human NKIRAS2, His-tagged | +Inquiry |
NKIRAS2-5891H | Recombinant Human NKIRAS2 Protein, GST-tagged | +Inquiry |
NKIRAS2-5596H | Recombinant Human NFKB Inhibitor Interacting Ras-Like 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKIRAS2-3817HCL | Recombinant Human NKIRAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKIRAS2 Products
Required fields are marked with *
My Review for All NKIRAS2 Products
Required fields are marked with *
0
Inquiry Basket