Recombinant Full Length Human NKX2-1 Protein, GST-tagged
Cat.No. : | NKX2-1-6855HF |
Product Overview : | Recombinant full-length human NKX2-1 (1-371) protein with a N-terminal GST-tag was expressed in Wheat Germ(in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 371 amino acids |
Description : | This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias 'TTF1' with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription. |
Molecular Mass : | 65 kDa |
AA Sequence : | MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW |
Applications : | AP, Array, ELISA, WB-Re |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer |
Gene Name | NKX2-1 NK2 homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | NKX2-1 |
Synonyms | NKX2-1; NK2 homeobox 1; BCH; BHC; NK-2; TEBP; TTF1; NKX2A; NMTC1; T/EBP; TITF1; TTF-1; NKX2.1; homeobox protein Nkx-2.1; NK-2 homolog A; homeobox protein NK-2 homolog A; thyroid nuclear factor 1; thyroid transcription factor 1; thyroid-specific enhancer-binding protein |
Gene ID | 7080 |
mRNA Refseq | NM_001079668 |
Protein Refseq | NP_001073136 |
MIM | 600635 |
UniProt ID | P43699 |
◆ Recombinant Proteins | ||
NKX2-1-3277H | Recombinant Human NKX2-1 protein, His&Myc-tagged | +Inquiry |
NKX2-1-01H | Recombinant Human NKX2-1 Protein, GST-tagged | +Inquiry |
NKX2-1-5133H | Recombinant Human NKX2-1 Protein (Ala40-Pro111), N-GST tagged | +Inquiry |
NKX2-1-6184C | Recombinant Chicken NKX2-1 | +Inquiry |
NKX2-1-226H | Recombinant Human NK2 Homeobox 1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX2-1 Products
Required fields are marked with *
My Review for All NKX2-1 Products
Required fields are marked with *
0
Inquiry Basket