Recombinant Human NKX2-1 protein, His&Myc-tagged
Cat.No. : | NKX2-1-3277H |
Product Overview : | Recombinant Human NKX2-1 protein(P43699)(1-371aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-371aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.0 kDa |
AA Sequence : | MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NKX2-1 NK2 homeobox 1 [ Homo sapiens ] |
Official Symbol | NKX2-1 |
Synonyms | NKX2-1; NK2 homeobox 1; BCH, benign chorea , NKX2A, thyroid transcription factor 1 , TITF1; homeobox protein Nkx-2.1; TTF 1; TTF1; NK-2 homolog A; thyroid nuclear factor 1; thyroid transcription factor 1; homeobox protein NK-2 homolog A; BCH; BHC; NK-2; TEBP; NKX2A; TITF1; TTF-1; NKX2.1; |
Gene ID | 7080 |
mRNA Refseq | NM_001079668 |
Protein Refseq | NP_001073136 |
MIM | 600635 |
UniProt ID | P43699 |
◆ Recombinant Proteins | ||
NKX2-1-226H | Recombinant Human NK2 Homeobox 1 | +Inquiry |
NKX2-1-10697M | Recombinant Mouse NKX2-1 Protein, His-tagged | +Inquiry |
NKX2-1-2824H | Recombinant Human NKX2-1 Protein, His-tagged, OVA Conjugated | +Inquiry |
NKX2-1-01H | Recombinant Human NKX2-1 Protein, GST-tagged | +Inquiry |
NKX2-1-384H | Recombinant Human NKX2-1 Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-1 Products
Required fields are marked with *
My Review for All NKX2-1 Products
Required fields are marked with *