Recombinant Full Length Human NLRP10 Protein, C-Flag-tagged
Cat.No. : | NLRP10-1119HFL |
Product Overview : | Recombinant Full Length Human NLRP10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). The protein encoded by this gene belongs to the NALP protein family despite lacking the LRR region. This protein likely plays a regulatory role in the innate immune system. The protein belongs to the signal-induced multiprotein complex, the inflammasome, that activates the pro-inflammatory caspases, caspase-1 and caspase-5. Other experiments indicate that this gene acts as a multifunctional negative regulator of inflammation and apoptosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74.9 kDa |
AA Sequence : | MAMAKARKPREALLWALSDLEENDFKKLKFYLRDMTLSEGQPPLARGELEGLIPVDLAELLISKYGEKEA VKVVLKGLKVMNLLELVDQLSHICLHDYREVYREHVRCLEEWQEAGVNGRYNQVLLVAKPSSESPESLAC PFPEQELESVTVEALFDSGEKPSLAPSLVVLQGSAGTGKTTLARKMVLDWATGTLYPGRFDYVFYVSCKE VVLLLESKLEQLLFWCCGDNQAPVTEILRQPERLLFILDGFDELQRPFEEKLKKRGLSPKESLLHLLIRR HTLPTCSLLITTRPLALRNLEPLLKQARHVHILGFSEEERARYFSSYFTDEKQADRAFDIVQKNDILYKA CQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRVLRSLCSLAAEG IQHQRFLFEEAELRKHNLDGPRLAAFLSSNDYQLGLAIKKFYSFRHISFQDFFHAMSYLVKEDQSRLGKE SRREVQRLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRT WDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQSQNLFSVKSSLSHGPKEEQKCPSVHGQKEGKDN IAGTQKEASTGKGRGTEETPKNTYITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NLRP10 NLR family pyrin domain containing 10 [ Homo sapiens (human) ] |
Official Symbol | NLRP10 |
Synonyms | NOD8; PAN5; PYNOD; NALP10; CLR11.1 |
Gene ID | 338322 |
mRNA Refseq | NM_176821.4 |
Protein Refseq | NP_789791.1 |
MIM | 609662 |
UniProt ID | Q86W26 |
◆ Recombinant Proteins | ||
NLRP10-5638H | Recombinant Human NLRP10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NLRP10-1517H | Recombinant Human NLRP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRP10-3707H | Recombinant Human NLRP10 protein, GST-tagged | +Inquiry |
Nlrp10-4434M | Recombinant Mouse Nlrp10 Protein, Myc/DDK-tagged | +Inquiry |
NLRP10-1119HFL | Recombinant Full Length Human NLRP10 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP10-3803HCL | Recombinant Human NLRP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NLRP10 Products
Required fields are marked with *
My Review for All NLRP10 Products
Required fields are marked with *
0
Inquiry Basket