Recombinant Full Length Human NME3 Protein, GST-tagged

Cat.No. : NME3-6573HF
Product Overview : Human NME3 full-length ORF ( AAH00250, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 169 amino acids
Description : NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3) is a Protein Coding gene. Among its related pathways are superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis and Pyrimidine metabolism (KEGG). GO annotations related to this gene include nucleoside diphosphate kinase activity. An important paralog of this gene is NME1.
Molecular Mass : 44.33 kDa
AA Sequence : MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ]
Official Symbol NME3
Synonyms NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516;
Gene ID 4832
mRNA Refseq NM_002513
Protein Refseq NP_002504
MIM 601817
UniProt ID Q13232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME3 Products

Required fields are marked with *

My Review for All NME3 Products

Required fields are marked with *

0
cart-icon
0
compare icon