Recombinant Full Length Human NME3 Protein, GST-tagged
Cat.No. : | NME3-6573HF |
Product Overview : | Human NME3 full-length ORF ( AAH00250, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 169 amino acids |
Description : | NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3) is a Protein Coding gene. Among its related pathways are superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis and Pyrimidine metabolism (KEGG). GO annotations related to this gene include nucleoside diphosphate kinase activity. An important paralog of this gene is NME1. |
Molecular Mass : | 44.33 kDa |
AA Sequence : | MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ] |
Official Symbol | NME3 |
Synonyms | NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516; |
Gene ID | 4832 |
mRNA Refseq | NM_002513 |
Protein Refseq | NP_002504 |
MIM | 601817 |
UniProt ID | Q13232 |
◆ Recombinant Proteins | ||
NME3-4711H | Recombinant Human NME3 Protein (Met1-Tyr168), N-His tagged | +Inquiry |
NME3-6110M | Recombinant Mouse NME3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NME3-3453H | Active Recombinant Human NME3 protein, His-tagged | +Inquiry |
NME3-10740M | Recombinant Mouse NME3 Protein | +Inquiry |
NME3-202H | Active Recombinant Human NME3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME3-1200HCL | Recombinant Human NME3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME3 Products
Required fields are marked with *
My Review for All NME3 Products
Required fields are marked with *