Recombinant Human NME3 protein, GST-tagged
| Cat.No. : | NME3-1312H |
| Product Overview : | Recombinant Human NME3 protein(22-169 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 22-169 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | NME3 |
| Synonyms | NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516; |
| Gene ID | 4832 |
| mRNA Refseq | NM_002513 |
| Protein Refseq | NP_002504 |
| MIM | 601817 |
| UniProt ID | Q13232 |
| ◆ Recombinant Proteins | ||
| NME3-5442C | Recombinant Chicken NME3 | +Inquiry |
| NME3-5928H | Recombinant Human NME3 Protein, GST-tagged | +Inquiry |
| NME3-1312H | Recombinant Human NME3 protein, GST-tagged | +Inquiry |
| NME3-202H | Active Recombinant Human NME3 protein, His-tagged | +Inquiry |
| NME3-6573HF | Recombinant Full Length Human NME3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME3-1200HCL | Recombinant Human NME3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME3 Products
Required fields are marked with *
My Review for All NME3 Products
Required fields are marked with *
