Recombinant Human NME3 protein, GST-tagged
Cat.No. : | NME3-1312H |
Product Overview : | Recombinant Human NME3 protein(22-169 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-169 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | NME3 |
Synonyms | NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516; |
Gene ID | 4832 |
mRNA Refseq | NM_002513 |
Protein Refseq | NP_002504 |
MIM | 601817 |
UniProt ID | Q13232 |
◆ Recombinant Proteins | ||
NME3-28749TH | Recombinant Human NME3, His-tagged | +Inquiry |
NME3-8569Z | Recombinant Zebrafish NME3 | +Inquiry |
NME3-3453H | Active Recombinant Human NME3 protein, His-tagged | +Inquiry |
Nme3-1762M | Recombinant Mouse Nme3 protein, His & T7-tagged | +Inquiry |
NME3-5928H | Recombinant Human NME3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME3-1200HCL | Recombinant Human NME3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME3 Products
Required fields are marked with *
My Review for All NME3 Products
Required fields are marked with *
0
Inquiry Basket