Recombinant Full Length Human NME4 Protein, GST-tagged

Cat.No. : NME4-6578HF
Product Overview : Human NME4 full-length ORF ( NP_005000.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 187 amino acids
Description : The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM
Molecular Mass : 47.1 kDa
AA Sequence : MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ]
Official Symbol NME4
Synonyms NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; NDPK-D; nm23-H4;
Gene ID 4833
mRNA Refseq NM_005009
Protein Refseq NP_005000
MIM 601818
UniProt ID O00746

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME4 Products

Required fields are marked with *

My Review for All NME4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon