Recombinant Human NME4, His-tagged
Cat.No. : | NME4-28746TH |
Product Overview : | Recombinant full length Human mature NME4 with an N terminal His tag; 176 amino acids, predicted MWt 19.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 155 amino acids |
Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al. |
Conjugation : | HIS |
Molecular Weight : | 19.600kDa inclusive of tags |
Tissue specificity : | Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
Sequence Similarities : | Belongs to the NDK family. |
Gene Name | NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ] |
Official Symbol | NME4 |
Synonyms | NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; |
Gene ID | 4833 |
mRNA Refseq | NM_005009 |
Protein Refseq | NP_005000 |
MIM | 601818 |
Uniprot ID | O00746 |
Chromosome Location | 16p13.3 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
Function | ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleoside diphosphate kinase activity; |
◆ Recombinant Proteins | ||
Nme4-1763M | Recombinant Mouse Nme4 protein, His & T7-tagged | +Inquiry |
NME4-795H | Recombinant Human NME4, His-tagged | +Inquiry |
NME4-1313H | Recombinant Human NME4, GST-tagged | +Inquiry |
NME4-196H | Active Recombinant Human NME4 protein, His-tagged | +Inquiry |
NME4-11412Z | Recombinant Zebrafish NME4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME4-3789HCL | Recombinant Human NME4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME4 Products
Required fields are marked with *
My Review for All NME4 Products
Required fields are marked with *
0
Inquiry Basket