Recombinant Human NME4, His-tagged
| Cat.No. : | NME4-28746TH |
| Product Overview : | Recombinant full length Human mature NME4 with an N terminal His tag; 176 amino acids, predicted MWt 19.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 155 amino acids |
| Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al. |
| Conjugation : | HIS |
| Molecular Weight : | 19.600kDa inclusive of tags |
| Tissue specificity : | Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA |
| Sequence Similarities : | Belongs to the NDK family. |
| Gene Name | NME4 non-metastatic cells 4, protein expressed in [ Homo sapiens ] |
| Official Symbol | NME4 |
| Synonyms | NME4; non-metastatic cells 4, protein expressed in; nucleoside diphosphate kinase, mitochondrial; nm23 H4; NM23H4; |
| Gene ID | 4833 |
| mRNA Refseq | NM_005009 |
| Protein Refseq | NP_005000 |
| MIM | 601818 |
| Uniprot ID | O00746 |
| Chromosome Location | 16p13.3 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
| Function | ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleoside diphosphate kinase activity; |
| ◆ Recombinant Proteins | ||
| NME4-5453H | Recombinant Human NME4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NME4-10741M | Recombinant Mouse NME4 Protein | +Inquiry |
| NME4-5930H | Recombinant Human NME4 Protein, GST-tagged | +Inquiry |
| NME4-5441C | Recombinant Chicken NME4 | +Inquiry |
| Nme4-1763M | Recombinant Mouse Nme4 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME4-3789HCL | Recombinant Human NME4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME4 Products
Required fields are marked with *
My Review for All NME4 Products
Required fields are marked with *
