Recombinant Full Length Human NNMT Protein, GST-tagged
| Cat.No. : | NNMT-6669HF |
| Product Overview : | Human NNMT full-length ORF ( AAH00234, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 264 amino acids |
| Description : | N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq |
| Molecular Mass : | 54.78 kDa |
| AA Sequence : | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NNMT nicotinamide N-methyltransferase [ Homo sapiens ] |
| Official Symbol | NNMT |
| Synonyms | NNMT; nicotinamide N-methyltransferase; |
| Gene ID | 4837 |
| mRNA Refseq | NM_006169 |
| Protein Refseq | NP_006160 |
| MIM | 600008 |
| UniProt ID | P40261 |
| ◆ Recombinant Proteins | ||
| NNMT-6669HF | Recombinant Full Length Human NNMT Protein, GST-tagged | +Inquiry |
| NNMT-2158HFL | Recombinant Full Length Human NNMT protein, Flag-tagged | +Inquiry |
| NNMT-452H | Recombinant Human NNMT protein, MYC/DDK-tagged | +Inquiry |
| NNMT-27994TH | Recombinant Human NNMT, T7 -tagged | +Inquiry |
| NNMT-6125M | Recombinant Mouse NNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NNMT-3779HCL | Recombinant Human NNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NNMT Products
Required fields are marked with *
My Review for All NNMT Products
Required fields are marked with *
