Recombinant Full Length Human NOSIP Protein, GST-tagged
| Cat.No. : | NOSIP-6713HF |
| Product Overview : | Human NOSIP full-length ORF ( NP_057037.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 301 amino acids |
| Description : | The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012] |
| Molecular Mass : | 59.6 kDa |
| AA Sequence : | MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NOSIP nitric oxide synthase interacting protein [ Homo sapiens ] |
| Official Symbol | NOSIP |
| Synonyms | NOSIP; nitric oxide synthase interacting protein; nitric oxide synthase-interacting protein; CGI 25; eNOS interacting protein; eNOS-interacting protein; CGI-25; |
| Gene ID | 51070 |
| mRNA Refseq | NM_015953 |
| Protein Refseq | NP_057037 |
| MIM | 616759 |
| UniProt ID | Q9Y314 |
| ◆ Recombinant Proteins | ||
| NOSIP-469H | Recombinant Human NOSIP Protein, His-tagged | +Inquiry |
| NOSIP-5994H | Recombinant Human NOSIP Protein, GST-tagged | +Inquiry |
| NOSIP-1812Z | Recombinant Zebrafish NOSIP | +Inquiry |
| NOSIP-2890R | Recombinant Rhesus Macaque NOSIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Nosip-4463M | Recombinant Mouse Nosip Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOSIP-3758HCL | Recombinant Human NOSIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOSIP Products
Required fields are marked with *
My Review for All NOSIP Products
Required fields are marked with *
