Recombinant Full Length Human NPPA Protein
| Cat.No. : | NPPA-347HF |
| Product Overview : | Recombinant full length Human ANP with N terminal proprietary tag; Predicted MWt 42.57 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 153 amino acids |
| Description : | The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. |
| Form : | Liquid |
| Molecular Mass : | 42.570kDa inclusive of tags |
| AA Sequence : | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDF KNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEV PPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | NPPA natriuretic peptide A [ Homo sapiens ] |
| Official Symbol | NPPA |
| Synonyms | NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A |
| Gene ID | 4878 |
| mRNA Refseq | NM_006172 |
| Protein Refseq | NP_006163 |
| MIM | 108780 |
| UniProt ID | P01160 |
| ◆ Recombinant Proteins | ||
| NPPA-6041H | Recombinant Human NPPA Protein, GST-tagged | +Inquiry |
| Nppa-263R | Recombinant Rat Nppa Protein, His-tagged | +Inquiry |
| Nppa-386R | Recombinant Rat Nppa Protein, His&GST-tagged | +Inquiry |
| NPPA-385H | Recombinant Human NPPA Protein, His-tagged | +Inquiry |
| Nppa-2212M | Recombinant Mouse Nppa protein(123-150aa), His-KSI-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPPA-3735HCL | Recombinant Human NPPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPA Products
Required fields are marked with *
My Review for All NPPA Products
Required fields are marked with *
