Recombinant Full Length Human NPPA Protein

Cat.No. : NPPA-347HF
Product Overview : Recombinant full length Human ANP with N terminal proprietary tag; Predicted MWt 42.57 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 153 amino acids
Description : The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6.
Form : Liquid
Molecular Mass : 42.570kDa inclusive of tags
AA Sequence : MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDF KNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEV PPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name NPPA natriuretic peptide A [ Homo sapiens ]
Official Symbol NPPA
Synonyms NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A
Gene ID 4878
mRNA Refseq NM_006172
Protein Refseq NP_006163
MIM 108780
UniProt ID P01160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPA Products

Required fields are marked with *

My Review for All NPPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon