Recombinant Full Length Human NPPB Protein, GST-tagged
Cat.No. : | NPPB-6643HF |
Product Overview : | Human NPPB full-length ORF ( AAH25785, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 134 amino acids |
Description : | This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The proteins biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq |
Molecular Mass : | 40.48 kDa |
AA Sequence : | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPPB natriuretic peptide B [ Homo sapiens ] |
Official Symbol | NPPB |
Synonyms | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID | 4879 |
mRNA Refseq | NM_002521 |
Protein Refseq | NP_002512 |
MIM | 600295 |
UniProt ID | P16860 |
◆ Recombinant Proteins | ||
NPPB-2769P | Recombinant Pig NPPB protein, His & GST-tagged | +Inquiry |
NPPB-2682H | Recombinant Human Natriuretic Peptides B, aa 1-76 | +Inquiry |
NPPB-2766D | Recombinant Dog NPPB protein, His & GST-tagged | +Inquiry |
NPPB-6042H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
NPPB-53H | Recombinant Human NPPB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *