Recombinant Full Length Human NPSR1 Protein
Cat.No. : | NPSR1-6648HF |
Product Overview : | Human NPSR1 full-length ORF (ADR82967.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 224 amino acids |
Description : | This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRVIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | NPSR1 neuropeptide S receptor 1 [ Homo sapiens ] |
Official Symbol | NPSR1 |
Synonyms | NPSR1; neuropeptide S receptor 1; G protein coupled receptor 154 , GPR154; neuropeptide S receptor; GPRA; PGR14; G protein-coupled receptor 154; G-protein coupled receptor 154; G-protein coupled receptor PGR14; vasopressin receptor-related receptor 1; G protein-coupled receptor for asthma susceptibility; G-protein coupled receptor for asthma susceptibility; NPSR; VRR1; ASRT2; GPR154; |
Gene ID | 387129 |
mRNA Refseq | NM_207172 |
Protein Refseq | NP_997055 |
MIM | 608595 |
UniProt ID | Q6W5P4 |
◆ Recombinant Proteins | ||
NPSR1-1348H | Recombinant Human NPSR1, GST-tagged | +Inquiry |
RFL32172MF | Recombinant Full Length Macaca Mulatta Neuropeptide S Receptor(Npsr1) Protein, His-Tagged | +Inquiry |
NPSR1-3082R | Recombinant Rhesus monkey NPSR1 Protein, His-tagged | +Inquiry |
RFL14224RF | Recombinant Full Length Rat Neuropeptide S Receptor(Npsr1) Protein, His-Tagged | +Inquiry |
NPSR1-5196H | Recombinant Human NPSR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPSR1 Products
Required fields are marked with *
My Review for All NPSR1 Products
Required fields are marked with *