Recombinant Full Length Human NPTX2 Protein, C-Flag-tagged
Cat.No. : | NPTX2-705HFL |
Product Overview : | Recombinant Full Length Human NPTX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP VETCEERLLDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | NPTX2 neuronal pentraxin 2 [ Homo sapiens (human) ] |
Official Symbol | NPTX2 |
Synonyms | NP2; NARP; NP-II |
Gene ID | 4885 |
mRNA Refseq | NM_002523.3 |
Protein Refseq | NP_002514.1 |
MIM | 600750 |
UniProt ID | P47972 |
◆ Recombinant Proteins | ||
NPTX2-705HFL | Recombinant Full Length Human NPTX2 Protein, C-Flag-tagged | +Inquiry |
NPTX2-487H | Recombinant Human NPTX2 | +Inquiry |
NPTX2-399H | Recombinant Human NPTX2 Protein, His-tagged | +Inquiry |
NPTX2-1533H | Recombinant Human NPTX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPTX2-1268H | Recombinant Human NPTX2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPTX2-1213HCL | Recombinant Human NPTX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPTX2 Products
Required fields are marked with *
My Review for All NPTX2 Products
Required fields are marked with *
0
Inquiry Basket