Recombinant Full Length Human NR1I2 Protein, GST-tagged
Cat.No. : | NR1I2-6702HF |
Product Overview : | Human NR1I2 full-length ORF ( NP_003880.3, 1 a.a. - 434 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 434 amino acids |
Description : | This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq |
Molecular Mass : | 76.2 kDa |
AA Sequence : | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR1I2 nuclear receptor subfamily 1, group I, member 2 [ Homo sapiens ] |
Official Symbol | NR1I2 |
Synonyms | NR1I2; nuclear receptor subfamily 1, group I, member 2; nuclear receptor subfamily 1 group I member 2; BXR; ONR1; PAR2; PXR; SXR; pregnane X receptor; orphan nuclear receptor PXR; orphan nuclear receptor PAR1; steroid and xenobiotic receptor; pregnane X nuclear receptor variant 2; PAR; PRR; SAR; PAR1; PARq; |
Gene ID | 8856 |
mRNA Refseq | NM_003889 |
Protein Refseq | NP_003880 |
MIM | 603065 |
UniProt ID | O75469 |
◆ Recombinant Proteins | ||
NR1I2-3724R | Recombinant Rat NR1I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR1I2-1537H | Recombinant Human NR1I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR1I2-4065R | Recombinant Rat NR1I2 Protein | +Inquiry |
NR1I2-1095H | Active Recombinant Human Nuclear Receptor Subfamily 1, Group I, Member 2 | +Inquiry |
NR1I2-0773H | Recombinant Human NR1I2 Protein (S130-S434), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR1I2-3718HCL | Recombinant Human NR1I2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR1I2 Products
Required fields are marked with *
My Review for All NR1I2 Products
Required fields are marked with *