Recombinant Full Length Human NR2F6 Protein, GST-tagged

Cat.No. : NR2F6-6742HF
Product Overview : Human NR2F6 full-length ORF (BAG37465.1, 1 a.a. - 404 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 404 amino acids
Description : NR2F6 (Nuclear Receptor Subfamily 2 Group F Member 6) is a Protein Coding gene. Among its related pathways are Nuclear Receptor transcription pathway and Circadian rythm related genes. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II distal enhancer sequence-specific DNA binding. An important paralog of this gene is NR2F2.
Molecular Mass : 70.84 kDa
AA Sequence : MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NR2F6 nuclear receptor subfamily 2, group F, member 6 [ Homo sapiens ]
Official Symbol NR2F6
Synonyms NR2F6; nuclear receptor subfamily 2, group F, member 6; ERBAL2; nuclear receptor subfamily 2 group F member 6; EAR 2; ERBA-related gene-2; V-erbA-related protein 2; nuclear receptor V-erbA-related; v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2; EAR2; EAR-2;
Gene ID 2063
mRNA Refseq NM_005234
Protein Refseq NP_005225
MIM 132880
UniProt ID P10588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2F6 Products

Required fields are marked with *

My Review for All NR2F6 Products

Required fields are marked with *

0
cart-icon
0
compare icon