Recombinant Full Length Human NR4A1 Protein, GST-tagged
Cat.No. : | NR4A1-6744HF |
Product Overview : | Human NR4A1 full-length ORF ( AAH16147, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 598 amino acids |
Description : | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq |
Molecular Mass : | 91.52 kDa |
AA Sequence : | MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTRGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR4A1 nuclear receptor subfamily 4, group A, member 1 [ Homo sapiens ] |
Official Symbol | NR4A1 |
Synonyms | NR4A1; nuclear receptor subfamily 4, group A, member 1; GFRP1, HMR; nuclear receptor subfamily 4 group A member 1; N10; NAK 1; NGFIB; NUR77; TR3; ST-59; hormone receptor; TR3 orphan receptor; steroid receptor TR3; testicular receptor 3; early response protein NAK1; orphan nuclear receptor HMR; orphan nuclear receptor TR3; nuclear hormone receptor NUR/77; growth factor-inducible nuclear protein N10; nerve growth factor IB nuclear receptor variant 1; HMR; NP10; GFRP1; NAK-1; MGC9485; |
Gene ID | 3164 |
mRNA Refseq | NM_001202233 |
Protein Refseq | NP_001189162 |
MIM | 139139 |
UniProt ID | P22736 |
◆ Recombinant Proteins | ||
NR4A1-394Z | Recombinant Zebrafish NR4A1 | +Inquiry |
NR4A1-6093H | Recombinant Human NR4A1 Protein, GST-tagged | +Inquiry |
Nr4a1-1143M | Recombinant Mouse Nr4a1 Protein, MYC/DDK-tagged | +Inquiry |
NR4A1-6744HF | Recombinant Full Length Human NR4A1 Protein, GST-tagged | +Inquiry |
NR4A1-3421H | Recombinant Human NR4A1 protein(1-598aa), His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A1-1219HCL | Recombinant Human NR4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR4A1 Products
Required fields are marked with *
My Review for All NR4A1 Products
Required fields are marked with *
0
Inquiry Basket