Recombinant Full Length Human NRAS Protein, C-Flag-tagged
Cat.No. : | NRAS-172HFL |
Product Overview : | Recombinant Full Length Human NRAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21 kDa |
AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP FIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | NRAS NRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
Official Symbol | NRAS |
Synonyms | NS6; CMNS; KRAS; NCMS; ALPS4; N-ras; NRAS1 |
Gene ID | 4893 |
mRNA Refseq | NM_002524.5 |
Protein Refseq | NP_002515.1 |
MIM | 164790 |
UniProt ID | P01111 |
◆ Recombinant Proteins | ||
NRAS-0936H | Recombinant Human NRAS Protein (T2-K169, Q61H), Tag Free | +Inquiry |
NRAS-1922C | Recombinant Chicken NRAS | +Inquiry |
NRAS-4076R | Recombinant Rat NRAS Protein | +Inquiry |
NRAS-6106H | Recombinant Human NRAS Protein, GST-tagged | +Inquiry |
NRAS-0935H | Recombinant Human NRAS Protein (T2-K169, Q61H), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *