Recombinant Full Length Human NSMCE4A Protein, C-Flag-tagged
Cat.No. : | NSMCE4A-712HFL |
Product Overview : | Recombinant Full Length Human NSMCE4A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in positive regulation of response to DNA damage stimulus. Located in nuclear body. Part of Smc5-Smc6 complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEPSDSGDEMMDP ASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTLFNEVSRAREAVLDAHFLVLA SDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENTFN KTHTFHFLLGSIYGECPVPKPRVDRPRKVPVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFRE DPDTPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQ GIIALSYRDWEIVKTFEISEPVITPSQRQQKPSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NSMCE4A NSE4 homolog A, SMC5-SMC6 complex component [ Homo sapiens (human) ] |
Official Symbol | NSMCE4A |
Synonyms | NS4EA; NSE4A; C10orf86 |
Gene ID | 54780 |
mRNA Refseq | NM_017615.3 |
Protein Refseq | NP_060085.2 |
MIM | 612987 |
UniProt ID | Q9NXX6 |
◆ Recombinant Proteins | ||
NSMCE4A-1551H | Recombinant Human NSMCE4A Protein, His (Fc)-Avi-tagged | +Inquiry |
NSMCE4A-2718Z | Recombinant Zebrafish NSMCE4A | +Inquiry |
NSMCE4A-712HFL | Recombinant Full Length Human NSMCE4A Protein, C-Flag-tagged | +Inquiry |
NSMCE4A-1183H | Recombinant Human NSMCE4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSMCE4A-443HCL | Recombinant Human NSMCE4A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSMCE4A Products
Required fields are marked with *
My Review for All NSMCE4A Products
Required fields are marked with *