Recombinant Full Length Human NT5C1A Protein, C-Flag-tagged

Cat.No. : NT5C1A-46HFL
Product Overview : Recombinant Full Length Human NT5C1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 40.8 kDa
AA Sequence : MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQI YTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINS INHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVVVSQSQLRVAF DGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLV TARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG
VAQTPRRTAPAKQAPSAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Full Length : Full L.
Gene Name NT5C1A 5'-nucleotidase, cytosolic IA [ Homo sapiens (human) ]
Official Symbol NT5C1A
Synonyms CN1; CNI; CN-I; CN1A; CN-IA
Gene ID 84618
mRNA Refseq NM_032526.3
Protein Refseq NP_115915.1
MIM 610525
UniProt ID Q9BXI3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NT5C1A Products

Required fields are marked with *

My Review for All NT5C1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon