Recombinant Full Length Human NT5C1A Protein, C-Flag-tagged
Cat.No. : | NT5C1A-46HFL |
Product Overview : | Recombinant Full Length Human NT5C1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQI YTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINS INHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVVVSQSQLRVAF DGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLV TARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG VAQTPRRTAPAKQAPSAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | NT5C1A 5'-nucleotidase, cytosolic IA [ Homo sapiens (human) ] |
Official Symbol | NT5C1A |
Synonyms | CN1; CNI; CN-I; CN1A; CN-IA |
Gene ID | 84618 |
mRNA Refseq | NM_032526.3 |
Protein Refseq | NP_115915.1 |
MIM | 610525 |
UniProt ID | Q9BXI3 |
◆ Recombinant Proteins | ||
NT5C1A-46HFL | Recombinant Full Length Human NT5C1A Protein, C-Flag-tagged | +Inquiry |
NT5C1A-6226M | Recombinant Mouse NT5C1A Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5C1A-1555H | Recombinant Human NT5C1A Protein, His (Fc)-Avi-tagged | +Inquiry |
NT5C1A-10922M | Recombinant Mouse NT5C1A Protein | +Inquiry |
Nt5c1a-4514M | Recombinant Mouse Nt5c1a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NT5C1A-444HCL | Recombinant Human NT5C1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NT5C1A Products
Required fields are marked with *
My Review for All NT5C1A Products
Required fields are marked with *