Recombinant Full Length Human NUDT11 Protein, C-Flag-tagged
Cat.No. : | NUDT11-2097HFL |
Product Overview : | Recombinant Full Length Human NUDT11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.4 kDa |
AA Sequence : | MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL EKLKLGGSPTNGNSMAPSSPDSDP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NUDT11 nudix hydrolase 11 [ Homo sapiens (human) ] |
Official Symbol | NUDT11 |
Synonyms | APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta |
Gene ID | 55190 |
mRNA Refseq | NM_018159.4 |
Protein Refseq | NP_060629.2 |
MIM | 300528 |
UniProt ID | Q96G61 |
◆ Recombinant Proteins | ||
NUDT11-418H | Recombinant Human NUDT11 | +Inquiry |
NUDT11-1559H | Recombinant Human NUDT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT11-1400H | Recombinant Human NUDT11, GST-tagged | +Inquiry |
NUDT11-4002H | Recombinant Human NUDT11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT11-3095H | Recombinant Human NUDT11 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT11-3653HCL | Recombinant Human NUDT11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUDT11 Products
Required fields are marked with *
My Review for All NUDT11 Products
Required fields are marked with *
0
Inquiry Basket