Recombinant Full Length Human NUDT11 Protein, C-Flag-tagged

Cat.No. : NUDT11-2097HFL
Product Overview : Recombinant Full Length Human NUDT11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 18.4 kDa
AA Sequence : MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL EKLKLGGSPTNGNSMAPSSPDSDP myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name NUDT11 nudix hydrolase 11 [ Homo sapiens (human) ]
Official Symbol NUDT11
Synonyms APS1; ASP1; DIPP3b; DIPP3beta; hDIPP3beta
Gene ID 55190
mRNA Refseq NM_018159.4
Protein Refseq NP_060629.2
MIM 300528
UniProt ID Q96G61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT11 Products

Required fields are marked with *

My Review for All NUDT11 Products

Required fields are marked with *

0
cart-icon
0
compare icon