Recombinant Full Length Human NUP37 Protein, C-Flag-tagged

Cat.No. : NUP37-2045HFL
Product Overview : Recombinant Full Length Human NUP37 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Nuclear pore complexes (NPCs) are used for transporting macromolecules between the cytoplasm and the nucleus. NPCs consist of multiple copies of 30 distinct proteins (nucleoporins), which assemble into biochemically-separable subcomplexes. The protein encoded by this gene is part of a subcomplex (Nup107-160) that is required for proper NPC function as well as for normal kinetochore-microtubule interaction and mitosis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 36.5 kDa
AA Sequence : MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFH HGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEI ASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVP LMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQF QIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name NUP37 nucleoporin 37 [ Homo sapiens (human) ]
Official Symbol NUP37
Synonyms p37; MCPH24
Gene ID 79023
mRNA Refseq NM_024057.4
Protein Refseq NP_076962.2
MIM 609264
UniProt ID Q8NFH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUP37 Products

Required fields are marked with *

My Review for All NUP37 Products

Required fields are marked with *

0
cart-icon