Recombinant Human NUP37 protein, His-tagged
| Cat.No. : | NUP37-3157H |
| Product Overview : | Recombinant Human NUP37 protein(53-102 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 53-102 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EEEADVEGIQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NUP37 nucleoporin 37kDa [ Homo sapiens ] |
| Official Symbol | NUP37 |
| Synonyms | NUP37; nucleoporin 37kDa; nucleoporin Nup37; FLJ22618; MGC5585; nup107-160 subcomplex subunit Nup37; p37; |
| Gene ID | 79023 |
| mRNA Refseq | NM_024057 |
| Protein Refseq | NP_076962 |
| MIM | 609264 |
| UniProt ID | Q8NFH4 |
| ◆ Recombinant Proteins | ||
| NUP37-2045HFL | Recombinant Full Length Human NUP37 Protein, C-Flag-tagged | +Inquiry |
| NUP37-1564H | Recombinant Human NUP37 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUP37-1980H | Recombinant Human NUP37 Protein, His-tagged | +Inquiry |
| NUP37-2956R | Recombinant Rhesus Macaque NUP37 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUP37-2021H | Recombinant Human NUP37 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUP37-3631HCL | Recombinant Human NUP37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP37 Products
Required fields are marked with *
My Review for All NUP37 Products
Required fields are marked with *
