Recombinant Full Length Human NXN Protein, C-Flag-tagged
Cat.No. : | NXN-1916HFL |
Product Overview : | Recombinant Full Length Human NXN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the thioredoxin superfamily, a group of small, multifunctional redox-active proteins. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. The encoded protein acts a redox-dependent regulator of the Wnt signaling pathway and is involved in cell growth and differentiation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGP GAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDA TTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRS LTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIM LDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQP IAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA FVNDFLAEKLKPEPI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | NXN nucleoredoxin [ Homo sapiens (human) ] |
Official Symbol | NXN |
Synonyms | NRX; RRS2; TRG-4 |
Gene ID | 64359 |
mRNA Refseq | NM_022463.5 |
Protein Refseq | NP_071908.2 |
MIM | 612895 |
UniProt ID | Q6DKJ4 |
◆ Recombinant Proteins | ||
NXN-2775Z | Recombinant Zebrafish NXN | +Inquiry |
NXN-1973H | Recombinant Human NXN Protein, MYC/DDK-tagged | +Inquiry |
NXN-774H | Recombinant Human NXN Protein, His-tagged | +Inquiry |
Nxn-776R | Recombinant Rat Nxn Protein, His-tagged | +Inquiry |
NXN-6286M | Recombinant Mouse NXN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXN-1239HCL | Recombinant Human NXN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NXN Products
Required fields are marked with *
My Review for All NXN Products
Required fields are marked with *
0
Inquiry Basket