Recombinant Full Length Human OCIAD1 Protein, C-Flag-tagged

Cat.No. : OCIAD1-2035HFL
Product Overview : Recombinant Full Length Human OCIAD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to be involved in several processes, including hematopoietic stem cell homeostasis; positive regulation of receptor signaling pathway via JAK-STAT; and regulation of stem cell differentiation. Located in membrane.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 27.4 kDa
AA Sequence : MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name OCIAD1 OCIA domain containing 1 [ Homo sapiens (human) ]
Official Symbol OCIAD1
Synonyms OCIA; ASRIJ; TPA018
Gene ID 54940
mRNA Refseq NM_017830.4
Protein Refseq NP_060300.1
MIM 619596
UniProt ID Q9NX40

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OCIAD1 Products

Required fields are marked with *

My Review for All OCIAD1 Products

Required fields are marked with *

0
cart-icon