Recombinant Full Length Human OCIAD1 Protein, C-Flag-tagged
Cat.No. : | OCIAD1-2035HFL |
Product Overview : | Recombinant Full Length Human OCIAD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in several processes, including hematopoietic stem cell homeostasis; positive regulation of receptor signaling pathway via JAK-STAT; and regulation of stem cell differentiation. Located in membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | OCIAD1 OCIA domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | OCIAD1 |
Synonyms | OCIA; ASRIJ; TPA018 |
Gene ID | 54940 |
mRNA Refseq | NM_017830.4 |
Protein Refseq | NP_060300.1 |
MIM | 619596 |
UniProt ID | Q9NX40 |
◆ Recombinant Proteins | ||
OCIAD1-1571H | Recombinant Human OCIAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ociad1-4568M | Recombinant Mouse Ociad1 Protein, Myc/DDK-tagged | +Inquiry |
Ociad1-5363R | Recombinant Rat Ociad1 protein, His&Myc-tagged | +Inquiry |
OCIAD1-26852TH | Recombinant Human OCIAD1, His-tagged | +Inquiry |
OCIAD1-3814R | Recombinant Rat OCIAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCIAD1-3606HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
OCIAD1-3605HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OCIAD1 Products
Required fields are marked with *
My Review for All OCIAD1 Products
Required fields are marked with *
0
Inquiry Basket