Recombinant Human OCIAD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OCIAD1-5910H
Product Overview : OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : OCIAD1 (OCIA Domain Containing 1) is a Protein Coding gene. Diseases associated with OCIAD1 include Ovarian Cancer and Ovarian Mucinous Neoplasm. An important paralog of this gene is OCIAD2.
Molecular Mass : 21.4 kDa
AA Sequence : MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGRNFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OCIAD1 OCIA domain containing 1 [ Homo sapiens (human) ]
Official Symbol OCIAD1
Synonyms OCIAD1; OCIA domain containing 1; OCIA domain-containing protein 1; Asrij; FLJ20455; OCIA; TPA018; ovarian carcinoma immunoreactive antigen; ASRIJ; MGC111072;
Gene ID 54940
mRNA Refseq NM_001079842
Protein Refseq NP_001073311
UniProt ID Q9NX40

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OCIAD1 Products

Required fields are marked with *

My Review for All OCIAD1 Products

Required fields are marked with *

0
cart-icon