Recombinant Human OCIAD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OCIAD1-5910H |
Product Overview : | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | OCIAD1 (OCIA Domain Containing 1) is a Protein Coding gene. Diseases associated with OCIAD1 include Ovarian Cancer and Ovarian Mucinous Neoplasm. An important paralog of this gene is OCIAD2. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGRNFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OCIAD1 OCIA domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | OCIAD1 |
Synonyms | OCIAD1; OCIA domain containing 1; OCIA domain-containing protein 1; Asrij; FLJ20455; OCIA; TPA018; ovarian carcinoma immunoreactive antigen; ASRIJ; MGC111072; |
Gene ID | 54940 |
mRNA Refseq | NM_001079842 |
Protein Refseq | NP_001073311 |
UniProt ID | Q9NX40 |
◆ Recombinant Proteins | ||
Ociad1-4568M | Recombinant Mouse Ociad1 Protein, Myc/DDK-tagged | +Inquiry |
OCIAD1-1571H | Recombinant Human OCIAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OCIAD1-26852TH | Recombinant Human OCIAD1, His-tagged | +Inquiry |
OCIAD1-11064M | Recombinant Mouse OCIAD1 Protein | +Inquiry |
Ociad1-5363R | Recombinant Rat Ociad1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCIAD1-3605HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
OCIAD1-3606HCL | Recombinant Human OCIAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCIAD1 Products
Required fields are marked with *
My Review for All OCIAD1 Products
Required fields are marked with *