Recombinant Full Length Human Olfactory Receptor 1E1(Or1E1) Protein, His-Tagged
| Cat.No. : | RFL26949HF |
| Product Overview : | Recombinant Full Length Human Olfactory receptor 1E1(OR1E1) Protein (P30953) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-314) |
| Form : | Lyophilized powder |
| AA Sequence : | MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | OR1E1 |
| Synonyms | OR1E1; OR1E5; OR1E6; OR1E9P; Olfactory receptor 1E1; Olfactory receptor 13-66; OR13-66; Olfactory receptor 17-2/17-32; OR17-2; OR17-32; Olfactory receptor 1E5; Olfactory receptor 1E6; Olfactory receptor 5-85; OR5-85; Olfactory receptor OR17-18; Olfactory |
| UniProt ID | P30953 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OR1E1 Products
Required fields are marked with *
My Review for All OR1E1 Products
Required fields are marked with *
