Recombinant Full Length Human Opalin(Opalin) Protein, His-Tagged
Cat.No. : | RFL3478HF |
Product Overview : | Recombinant Full Length Human Opalin(OPALIN) Protein (Q96PE5) (1-141aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-141) |
Form : | Lyophilized powder |
AA Sequence : | MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPALIN |
Synonyms | OPALIN; HTMP10; TMEM10; Opalin; Oligodendrocytic myelin paranodal and inner loop protein; Transmembrane protein 10 |
UniProt ID | Q96PE5 |
◆ Recombinant Proteins | ||
OPALIN-567H | Recombinant Human OPALIN, Fc tagged | +Inquiry |
RFL31596BF | Recombinant Full Length Bovine Opalin(Opalin) Protein, His-Tagged | +Inquiry |
RFL3478HF | Recombinant Full Length Human Opalin(Opalin) Protein, His-Tagged | +Inquiry |
OPALIN-3249H | Recombinant Human OPALIN protein(Thr51-Glu141), mFc-tagged | +Inquiry |
RFL27272MF | Recombinant Full Length Mouse Opalin(Opalin) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OPALIN-1146HCL | Recombinant Human OPALIN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OPALIN Products
Required fields are marked with *
My Review for All OPALIN Products
Required fields are marked with *