Recombinant Full Length Human OR51E2 Protein, C-Flag-tagged
Cat.No. : | OR51E2-952HFL |
Product Overview : | Recombinant Full Length Human OR51E2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.3 kDa |
AA Sequence : | MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDL ALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVT AQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDV MFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYL LLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, GPCR, Transmembrane |
Protein Pathways : | Olfactory transduction |
Full Length : | Full L. |
Gene Name | OR51E2 olfactory receptor family 51 subfamily E member 2 [ Homo sapiens (human) ] |
Official Symbol | OR51E2 |
Synonyms | PSGR; HPRAJ; OR52A2; OR51E3P |
Gene ID | 81285 |
mRNA Refseq | NM_030774.4 |
Protein Refseq | NP_110401.1 |
MIM | 611268 |
UniProt ID | Q9H255 |
◆ Cell & Tissue Lysates | ||
OR51E2-3558HCL | Recombinant Human OR51E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OR51E2 Products
Required fields are marked with *
My Review for All OR51E2 Products
Required fields are marked with *