Recombinant Full Length Human ORM1 Protein, C-Flag-tagged
Cat.No. : | ORM1-638HFL |
Product Overview : | Recombinant Full Length Human ORM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT PNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNW GLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | ORM1 orosomucoid 1 [ Homo sapiens (human) ] |
Official Symbol | ORM1 |
Synonyms | ORM; AGP1; AGP-A; HEL-S-153w |
Gene ID | 5004 |
mRNA Refseq | NM_000607.4 |
Protein Refseq | NP_000598.2 |
MIM | 138600 |
UniProt ID | P02763 |
◆ Recombinant Proteins | ||
ORM1-3864R | Recombinant Rat ORM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ORM1-12189M | Recombinant Mouse ORM1 Protein | +Inquiry |
Orm1-1076R | Recombinant Rat Orm1 protein | +Inquiry |
ORM1-4202R | Recombinant Rat ORM1 Protein | +Inquiry |
Orm1-7746M | Recombinant Mouse Orm1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORM1 Products
Required fields are marked with *
My Review for All ORM1 Products
Required fields are marked with *