Recombinant Full Length Human ORM1 Protein, C-Flag-tagged
| Cat.No. : | ORM1-638HFL |
| Product Overview : | Recombinant Full Length Human ORM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 21.5 kDa |
| AA Sequence : | MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT PNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNW GLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Secreted Protein |
| Full Length : | Full L. |
| Gene Name | ORM1 orosomucoid 1 [ Homo sapiens (human) ] |
| Official Symbol | ORM1 |
| Synonyms | ORM; AGP1; AGP-A; HEL-S-153w |
| Gene ID | 5004 |
| mRNA Refseq | NM_000607.4 |
| Protein Refseq | NP_000598.2 |
| MIM | 138600 |
| UniProt ID | P02763 |
| ◆ Recombinant Proteins | ||
| Orm1-4450R | Recombinant Rat Orm1 protein, His-tagged | +Inquiry |
| ORM1-7750R | Recombinant Rabbit ORM1 protein, His & T7-tagged | +Inquiry |
| a1AGP-3298R | Recombinant Rat a1AGP, His-tagged, GST-tagged | +Inquiry |
| Orm1-7748R | Recombinant Rat Orm1 protein, His-tagged | +Inquiry |
| Orm1-7746M | Recombinant Mouse Orm1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
| ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
| ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
| ORM1-26392TH | Native Human ORM1 | +Inquiry |
| ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORM1 Products
Required fields are marked with *
My Review for All ORM1 Products
Required fields are marked with *
