Recombinant Full Length Human OSM Protein, C-Flag-tagged
Cat.No. : | OSM-945HFL |
Product Overview : | Recombinant Full Length Human OSM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells. This gene and the related gene, leukemia inhibitory factor, also present on chromosome 22, may have resulted from the duplication of a common ancestral gene. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKL REHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMAR PNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFS KWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways : | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | OSM oncostatin M [ Homo sapiens (human) ] |
Official Symbol | OSM |
Synonyms | MGC20461 |
Gene ID | 5008 |
mRNA Refseq | NM_020530.6 |
Protein Refseq | NP_065391.1 |
MIM | 165095 |
UniProt ID | P13725 |
◆ Recombinant Proteins | ||
Osm-585R | Recombinant Rat Osm protein | +Inquiry |
OSM-463H | Recombinant Human OSM protein, His-tagged | +Inquiry |
OSM-3870R | Recombinant Rat OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
OSM-43H | Active Recombinant Human OSM Protein, Animal Free | +Inquiry |
OSM-725HB | Recombinant Human OSM protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket