Recombinant Full Length Human OTC Protein, C-Flag-tagged
Cat.No. : | OTC-993HFL |
Product Overview : | Recombinant Full Length Human OTC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This nuclear gene encodes a mitochondrial matrix enzyme. The encoded protein is involved in the urea cycle which functions to detoxify ammonia into urea for excretion. Mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA RVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAK FGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQA FQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQ KPKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | OTC ornithine transcarbamylase [ Homo sapiens (human) ] |
Official Symbol | OTC |
Synonyms | OCTD; OTC1; OTCD; OTCase |
Gene ID | 5009 |
mRNA Refseq | NM_000531.6 |
Protein Refseq | NP_000522.3 |
MIM | 300461 |
UniProt ID | P00480 |
◆ Recombinant Proteins | ||
OTC-6425M | Recombinant Mouse OTC Protein, His (Fc)-Avi-tagged | +Inquiry |
OTC-4215R | Recombinant Rat OTC Protein | +Inquiry |
OTC-3877R | Recombinant Rat OTC Protein, His (Fc)-Avi-tagged | +Inquiry |
OTC-3309H | Recombinant Human OTC protein, His-SUMO-tagged | +Inquiry |
OTC-12224M | Recombinant Mouse OTC Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTC Products
Required fields are marked with *
My Review for All OTC Products
Required fields are marked with *