Recombinant Full Length Human PAFAH1B2 Protein, C-Flag-tagged

Cat.No. : PAFAH1B2-2026HFL
Product Overview : Recombinant Full Length Human PAFAH1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 25.4 kDa
AA Sequence : MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH ELIMQLLEETPEEKQTTIA myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Ether lipid metabolism, Metabolic pathways
Full Length : Full L.
Gene Name PAFAH1B2 platelet activating factor acetylhydrolase 1b catalytic subunit 2 [ Homo sapiens (human) ]
Official Symbol PAFAH1B2
Synonyms HEL-S-303
Gene ID 5049
mRNA Refseq NM_002572.4
Protein Refseq NP_002563.1
MIM 602508
UniProt ID P68402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAFAH1B2 Products

Required fields are marked with *

My Review for All PAFAH1B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon