Recombinant Full Length Human PAFAH1B3 Protein

• Cat.No.: PAFAH1B3-359HF
• Product Overview: Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 231 amino acids
• Description: This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
• Form: Liquid
• Molecular Mass: 51.520kDa inclusive of tags
• AA Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ]
• Official Symbol: PAFAH1B3
• Synonyms: PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a
• Gene ID: 5050
• mRNA Refseq: NM_001145939
• Protein Refseq: NP_001139411
• MIM: 603074
• UniProt ID: Q15102