Recombinant Full Length Human PAFAH1B3 Protein
| Cat.No. : | PAFAH1B3-359HF |
| Product Overview : | Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 231 amino acids |
| Description : | This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. |
| Form : | Liquid |
| Molecular Mass : | 51.520kDa inclusive of tags |
| AA Sequence : | MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ] |
| Official Symbol | PAFAH1B3 |
| Synonyms | PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a |
| Gene ID | 5050 |
| mRNA Refseq | NM_001145939 |
| Protein Refseq | NP_001139411 |
| MIM | 603074 |
| UniProt ID | Q15102 |
| ◆ Recombinant Proteins | ||
| PAFAH1B3-3285R | Recombinant Rhesus monkey PAFAH1B3 Protein, His-tagged | +Inquiry |
| PAFAH1B3-3917R | Recombinant Rat PAFAH1B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pafah1b3-6902M | Recombinant Mouse Pafah1b3 protein, His & T7-tagged | +Inquiry |
| PAFAH1B3-6901H | Recombinant Human PAFAH1B3 protein, His & T7-tagged | +Inquiry |
| PAFAH1B3-4255R | Recombinant Rat PAFAH1B3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAFAH1B3-3467HCL | Recombinant Human PAFAH1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAFAH1B3 Products
Required fields are marked with *
My Review for All PAFAH1B3 Products
Required fields are marked with *
