Recombinant Full Length Human PAFAH1B3 Protein

Cat.No. : PAFAH1B3-359HF
Product Overview : Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 231 amino acids
Description : This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
Form : Liquid
Molecular Mass : 51.520kDa inclusive of tags
AA Sequence : MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ]
Official Symbol PAFAH1B3
Synonyms PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a
Gene ID 5050
mRNA Refseq NM_001145939
Protein Refseq NP_001139411
MIM 603074
UniProt ID Q15102

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAFAH1B3 Products

Required fields are marked with *

My Review for All PAFAH1B3 Products

Required fields are marked with *

0
cart-icon