Recombinant Full Length Human Palmitoyltransferase Zdhhc15(Zdhhc15) Protein, His-Tagged
Cat.No. : | RFL25219HF |
Product Overview : | Recombinant Full Length Human Palmitoyltransferase ZDHHC15(ZDHHC15) Protein (Q96MV8) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL YHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVY TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR NKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSM NESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC15 |
Synonyms | ZDHHC15; UNQ1969/PRO4501; Palmitoyltransferase ZDHHC15; Acyltransferase ZDHHC15; Zinc finger DHHC domain-containing protein 15; DHHC-15 |
UniProt ID | Q96MV8 |
◆ Recombinant Proteins | ||
ZDHHC15-5278R | Recombinant Rhesus monkey ZDHHC15 Protein, His-tagged | +Inquiry |
RFL19461XF | Recombinant Full Length Xenopus Laevis Palmitoyltransferase Zdhhc15(Zdhhc15) Protein, His-Tagged | +Inquiry |
ZDHHC15-6660R | Recombinant Rat ZDHHC15 Protein | +Inquiry |
AIFM2-9504H | Recombinant Human AIFM2 protein, GST-tagged | +Inquiry |
RFL3116MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc15(Zdhhc15) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC15-195HCL | Recombinant Human ZDHHC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC15 Products
Required fields are marked with *
My Review for All ZDHHC15 Products
Required fields are marked with *
0
Inquiry Basket