Recombinant Full Length Human PANK2 Protein, C-Flag-tagged
Cat.No. : | PANK2-1526HFL |
Product Overview : | Recombinant Full Length Human PANK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.1 kDa |
AA Sequence : | MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV GALLELLKIPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Pantothenate and CoA biosynthesis |
Full Length : | Full L. |
Gene Name | PANK2 pantothenate kinase 2 [ Homo sapiens (human) ] |
Official Symbol | PANK2 |
Synonyms | HSS; HARP; PKAN; NBIA1; C20orf48 |
Gene ID | 80025 |
mRNA Refseq | NM_153638.4 |
Protein Refseq | NP_705902.2 |
MIM | 606157 |
UniProt ID | Q9BZ23 |
◆ Recombinant Proteins | ||
Pank2-4669M | Recombinant Mouse Pank2 Protein, Myc/DDK-tagged | +Inquiry |
PANK2-3173H | Recombinant Human PANK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Pank2-1896M | Recombinant Mouse Pank2 Protein, His-tagged | +Inquiry |
PANK2-2543H | Recombinant Human PANK2 Protein, His-tagged | +Inquiry |
PANK2-5102Z | Recombinant Zebrafish PANK2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANK2-3445HCL | Recombinant Human PANK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PANK2 Products
Required fields are marked with *
My Review for All PANK2 Products
Required fields are marked with *
0
Inquiry Basket