Recombinant Full Length Human PCGF1 Protein, GST-tagged
Cat.No. : | PCGF1-20HFL |
Product Overview : | Recombinant Full Length Human PCGF1 Protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-247 aa |
Description : | PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development. |
Tag : | N-GST |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR |
Applications : | Enzyme-linked Immunoabsorbent Assay;Western Blot (Recombinant protein);Antibody Production;Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PCGF1 polycomb group ring finger 1 [ Homo sapiens (human) ] |
Official Symbol | PCGF1 |
Synonyms | 2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68,PCGF1 |
Gene ID | 84759 |
mRNA Refseq | NM_032673 |
Protein Refseq | NP_116062 |
UniProt ID | Q9BSM1 |
◆ Recombinant Proteins | ||
PCGF1-4297R | Recombinant Rat PCGF1 Protein | +Inquiry |
PCGF1-1574H | Recombinant Human PCGF1, His-tagged | +Inquiry |
PCGF1-12489M | Recombinant Mouse PCGF1 Protein | +Inquiry |
PCGF1-20HFL | Recombinant Full Length Human PCGF1 Protein, GST-tagged | +Inquiry |
PCGF1-3959R | Recombinant Rat PCGF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCGF1-1308HCL | Recombinant Human PCGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCGF1 Products
Required fields are marked with *
My Review for All PCGF1 Products
Required fields are marked with *