Recombinant Full Length Human PCGF1 Protein, GST-tagged

• Cat.No.: PCGF1-20HFL
• Product Overview: Recombinant Full Length Human PCGF1 Protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-247 aa
• Description: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.
• Tag: N-GST
• Molecular Mass: 55.6 kDa
• AA Sequence: MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
• Applications: Enzyme-linked Immunoabsorbent Assay;Western Blot (Recombinant protein);Antibody Production;Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PCGF1 polycomb group ring finger 1 [ Homo sapiens (human) ]
• Official Symbol: PCGF1
• Synonyms: 2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68,PCGF1
• Gene ID: 84759
• mRNA Refseq: NM_032673
• Protein Refseq: NP_116062
• UniProt ID: Q9BSM1