Recombinant Full Length Human PCGF1 Protein, GST-tagged

Cat.No. : PCGF1-20HFL
Product Overview : Recombinant Full Length Human PCGF1 Protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-247 aa
Description : PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.
Tag : N-GST
Molecular Mass : 55.6 kDa
AA Sequence : MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Applications : Enzyme-linked Immunoabsorbent Assay;Western Blot (Recombinant protein);Antibody Production;Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PCGF1 polycomb group ring finger 1 [ Homo sapiens (human) ]
Official Symbol PCGF1
Synonyms 2010002K04Rik, FLJ43754, MGC10882, NSPC1, RNF3A-2, RNF68,PCGF1
Gene ID 84759
mRNA Refseq NM_032673
Protein Refseq NP_116062
UniProt ID Q9BSM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCGF1 Products

Required fields are marked with *

My Review for All PCGF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon