Recombinant Full Length Human PCSK9 Protein, C-Flag-tagged
Cat.No. : | PCSK9-1321HFL |
Product Overview : | Recombinant Full Length Human PCSK9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71 kDa |
AA Sequence : | MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHV DYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPE EDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGT LGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFS RSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PCSK9 proprotein convertase subtilisin/kexin type 9 [ Homo sapiens (human) ] |
Official Symbol | PCSK9 |
Synonyms | FH3; PC9; FHCL3; NARC1; LDLCQ1; NARC-1; HCHOLA3 |
Gene ID | 255738 |
mRNA Refseq | NM_174936.4 |
Protein Refseq | NP_777596.2 |
MIM | 607786 |
UniProt ID | Q8NBP7 |
◆ Recombinant Proteins | ||
PCSK9-804H | Recombinant Human PCSK9 Protein, His-tagged | +Inquiry |
PCSK9-201H | Recombinant Human PCSK9, His-tagged, C13&N15 Labeled | +Inquiry |
PCSK9-406C | Recombinant Chinese hamster PCSK9 Protein, His-tagged | +Inquiry |
PCSK9-203H | Recombinant Human PCSK9 Protein, GLN31-GLN692, Tag Free, Biotinylated | +Inquiry |
PCSK9-2138HB | Recombinant Human PCSK9 protein, mFc-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK9-2875HCL | Recombinant Human PCSK9 cell lysate | +Inquiry |
PCSK9-2306RCL | Recombinant Rat PCSK9 cell lysate | +Inquiry |
PCSK9-2775RCL | Recombinant Rhesus PCSK9 cell lysate | +Inquiry |
PCSK9-2564MCL | Recombinant Mouse PCSK9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCSK9 Products
Required fields are marked with *
My Review for All PCSK9 Products
Required fields are marked with *
0
Inquiry Basket