Recombinant Full Length Human PDCD1 Protein, C-Flag-tagged
Cat.No. : | PDCD1-122HFL |
Product Overview : | Recombinant Full Length Human PDCD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE DGHCSWPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), T cell receptor signaling pathway |
Full Length : | Full L. |
Gene Name | PDCD1 programmed cell death 1 [ Homo sapiens (human) ] |
Official Symbol | PDCD1 |
Synonyms | PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1 |
Gene ID | 5133 |
mRNA Refseq | NM_005018.3 |
Protein Refseq | NP_005009.2 |
MIM | 600244 |
UniProt ID | Q15116 |
◆ Recombinant Proteins | ||
PDCD1-695H | Recombinant Human PDCD1 Protein, Fc-tagged | +Inquiry |
PDCD1-031HA | Recombinant Human PDCD1 protein, MIgG2a Fc-tagged, APC labeled | +Inquiry |
PDCD1-372R | Recombinant Rabbit PDCD1 protein, Fc-tagged | +Inquiry |
PDCD1-0614H | Active Recombinant Human PDCD1 protein, lFc-tagged | +Inquiry |
PDCD1-189H | Active Recombinant Human PDCD1, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
PDCD1-001RCL | Recombinant Rat PDCD1 cell lysate | +Inquiry |
PDCD1-2628MCL | Recombinant Mouse PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD1 Products
Required fields are marked with *
My Review for All PDCD1 Products
Required fields are marked with *
0
Inquiry Basket